| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries) |
| Domain d3cyna1: 3cyn A:44-209 [199221] Other proteins in same PDB: d3cyna2, d3cynb2, d3cync2 automated match to d3cync_ complexed with gol, so4 |
PDB Entry: 3cyn (more details), 2 Å
SCOPe Domain Sequences for d3cyna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cyna1 c.47.1.0 (A:44-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
insfyafevkdakgrtvslekykgkvslvvnvasdcqltdrnylglkelhkefgpshfsv
lafpcnqfgeseprpskevesfarknygvtfpifhkikilgsegepafrflvdsskkepr
wnfwkylvnpegqvvkfwrpeepievirpdiaalvrqviikkkedl
Timeline for d3cyna1:
View in 3DDomains from other chains: (mouse over for more information) d3cynb1, d3cynb2, d3cync1, d3cync2 |