Lineage for d3cxga1 (3cxg A:19-131)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880117Species Plasmodium falciparum [195607] (1 PDB entry)
  8. 2880118Domain d3cxga1: 3cxg A:19-131 [199220]
    Other proteins in same PDB: d3cxga2, d3cxgb2
    automated match to d3cxgb_
    complexed with gol, so4

Details for d3cxga1

PDB Entry: 3cxg (more details), 2 Å

PDB Description: crystal structure of plasmodium falciparum thioredoxin, pfi0790w
PDB Compounds: (A:) putative thioredoxin

SCOPe Domain Sequences for d3cxga1:

Sequence, based on SEQRES records: (download)

>d3cxga1 c.47.1.0 (A:19-131) automated matches {Plasmodium falciparum}
qsiyielkntgslnqvfsstqnssivikfgavwckpcnkikeyfknqlnyyyvtlvdidv
dihpklndqhnikalptfefyfnlnnewvlvhtveganqndiekafqkyclek

Sequence, based on observed residues (ATOM records): (download)

>d3cxga1 c.47.1.0 (A:19-131) automated matches {Plasmodium falciparum}
qsiyielkntgslnqvfssqnssivikfgavwckpcnkikeyfknqlnyyyvtlvdidvd
ihpklndqhnikalptfefyfnlnnewvlvhtveganqndiekafqkyclek

SCOPe Domain Coordinates for d3cxga1:

Click to download the PDB-style file with coordinates for d3cxga1.
(The format of our PDB-style files is described here.)

Timeline for d3cxga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cxga2