| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Plasmodium falciparum [195607] (1 PDB entry) |
| Domain d3cxga1: 3cxg A:19-131 [199220] Other proteins in same PDB: d3cxga2, d3cxgb2 automated match to d3cxgb_ complexed with gol, so4 |
PDB Entry: 3cxg (more details), 2 Å
SCOPe Domain Sequences for d3cxga1:
Sequence, based on SEQRES records: (download)
>d3cxga1 c.47.1.0 (A:19-131) automated matches {Plasmodium falciparum}
qsiyielkntgslnqvfsstqnssivikfgavwckpcnkikeyfknqlnyyyvtlvdidv
dihpklndqhnikalptfefyfnlnnewvlvhtveganqndiekafqkyclek
>d3cxga1 c.47.1.0 (A:19-131) automated matches {Plasmodium falciparum}
qsiyielkntgslnqvfssqnssivikfgavwckpcnkikeyfknqlnyyyvtlvdidvd
ihpklndqhnikalptfefyfnlnnewvlvhtveganqndiekafqkyclek
Timeline for d3cxga1: