SCOPe 2.03: Domain d3cvhr1: 3cvh R:1-106

Lineage for d3cvhr1 (3cvh R:1-106)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d3cvhr1: 3cvh R:1-106 [199216]
   Other proteins in same PDB: d3cvha1, d3cvha2, d3cvhb_, d3cvhh1, d3cvhl2, d3cvhm1, d3cvhm2, d3cvhn_, d3cvhq1, d3cvhr2
   automated match to d1c12a1

Details for d3cvhr1

PDB Entry: 3cvh, 2.9 Å

PDB Description: how tcr-like antibody recognizes mhc-bound peptide

PDB Compounds: (R:) 25-D1.16 Light chain

SCOPe Domain Sequences for d3cvhr1:

Sequence; same for both SEQRES and ATOM records:

>d3cvhr1 b.1.1.0 (R:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqvtqssssfsvslgdrvtitckasediynrlawyqqkpgnaprllisgatsletgvpdr
fsgsgsrkdytliitslqtedvatyycqqywstpltfgagtklelk

Timeline for d3cvhr1:

• d3cvhr1 is new in SCOPe 2.03-stable
  
• d3cvhr1 appears in SCOPe 2.04
  
• d3cvhr1 appears in the current release, SCOPe 2.08