SCOPe 2.08: Domain d3cvhl2: 3cvh L:107-209

Lineage for d3cvhl2 (3cvh L:107-209)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3cvhl2: 3cvh L:107-209 [199215]
   Other proteins in same PDB: d3cvha1, d3cvha2, d3cvhb_, d3cvhh_, d3cvhl1, d3cvhm1, d3cvhm2, d3cvhn_, d3cvhq_, d3cvhr1
   automated match to d1c12a2

Details for d3cvhl2

PDB Entry: 3cvh, 2.9 Å

PDB Description: how tcr-like antibody recognizes mhc-bound peptide

PDB Compounds: (L:) 25-D1.16 Light chain

SCOPe Domain Sequences for d3cvhl2:

Sequence; same for both SEQRES and ATOM records:

>d3cvhl2 b.1.1.2 (L:107-209) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

Timeline for d3cvhl2:

• d3cvhl2 first appeared in SCOPe 2.03
  
• d3cvhl2 appears in SCOPe 2.07