Lineage for d3ctmg_ (3ctm G:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094674Species Candida parapsilosis [TaxId:5480] [195408] (1 PDB entry)
  8. 2094681Domain d3ctmg_: 3ctm G: [199213]
    automated match to d3ctmh_

Details for d3ctmg_

PDB Entry: 3ctm (more details), 2.69 Å

PDB Description: Crystal Structure of a Carbonyl Reductase from Candida Parapsilosis with anti-Prelog Stereo-specificity
PDB Compounds: (G:) carbonyl reductase

SCOPe Domain Sequences for d3ctmg_:

Sequence, based on SEQRES records: (download)

>d3ctmg_ c.2.1.0 (G:) automated matches {Candida parapsilosis [TaxId: 5480]}
eiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagadva
iwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanagvt
wtqgpeidvdnydswnkiisvdlngvyycshnigkifkkngkgsliitssisgkivnipq
lqapyntakaacthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltplg
regltqelvggylylasnastfttgsdvvidggyt

Sequence, based on observed residues (ATOM records): (download)

>d3ctmg_ c.2.1.0 (G:) automated matches {Candida parapsilosis [TaxId: 5480]}
eiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagadva
iwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanagvt
wtvdnydswnkiisvdlngvyycshnigkifkkngkgsliitssisgkiqlqapyntaka
acthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltplgregltqelvg
gylylasnastfttgsdvvidggyt

SCOPe Domain Coordinates for d3ctmg_:

Click to download the PDB-style file with coordinates for d3ctmg_.
(The format of our PDB-style files is described here.)

Timeline for d3ctmg_: