SCOP 1.69: Domain d1cgsh1: 1cgs H:1-117

Lineage for d1cgsh1 (1cgs H:1-117)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)

8. Domain d1cgsh1: 1cgs H:1-117 [19921]
   Other proteins in same PDB: d1cgsh2, d1cgsl1, d1cgsl2
   part of an anti-sweetener Fab

Details for d1cgsh1

PDB Entry: 1cgs, 2.6 Å

PDB Description: local and transmitted conformational changes on complexation of an anti-sweetener fab

SCOP Domain Sequences for d1cgsh1:

Sequence; same for both SEQRES and ATOM records:

>d1cgsh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
rvqllesgaelmkpgasvqisckatgytfseywiewvkerpghglewigeilpgsgrtny
rekfkgkatftadtssntaymqlssltsedsavyyctrgyssmdywgqgtsvtvsaa

Timeline for d1cgsh1:

• d1cgsh1 first appeared (with stable ids) in SCOP 1.55
  
• d1cgsh1 appears in SCOP 1.67
  
• d1cgsh1 appears in SCOP 1.71
  
• d1cgsh1 appears in the current release, SCOPe 2.08