SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3clfl2 (3clf L:108-214)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (12 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (451 PDB entries)
  8. 2025494Domain d3clfl2: 3clf L:108-214 [199202]
    Other proteins in same PDB: d3clfh1, d3clfl1
    automated match to d12e8l2

Details for d3clfl2

PDB Entry: 3clf (more details), 2 Å

PDB Description: HIV neutralizing monoclonal antibody YZ23
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d3clfl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3clfl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d3clfl2:

Click to download the PDB-style file with coordinates for d3clfl2.
(The format of our PDB-style files is described here.)

Timeline for d3clfl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3clfl1
View in 3D
Domains from other chains:
(mouse over for more information)
d3clfh1