SCOPe 2.05: Domain d3clel2: 3cle L:108-212

Lineage for d3clel2 (3cle L:108-212)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d3clel2: 3cle L:108-212 [199200]
   Other proteins in same PDB: d3cleh1, d3clel1
   automated match to d12e8l2

Details for d3clel2

PDB Entry: 3cle, 2.5 Å

PDB Description: hiv neutralizing monoclonal antibody yz23

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d3clel2:

Sequence; same for both SEQRES and ATOM records:

>d3clel2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d3clel2:

• d3clel2 first appeared in SCOPe 2.03
  
• d3clel2 appears in SCOPe 2.04
  
• d3clel2 appears in SCOPe 2.06
  
• d3clel2 appears in the current release, SCOPe 2.08