SCOPe 2.03: Domain d3ckib_: 3cki B:

Lineage for d3ckib_ (3cki B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.3: TIMP-like [50242] (4 families)

5. Family b.40.3.0: automated matches [227229] (1 protein)
   not a true family

6. Protein automated matches [226975] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [225497] (1 PDB entry)

8. Domain d3ckib_: 3cki B: [199198]
   Other proteins in same PDB: d3ckia_
   automated match to d3ma2b_
   complexed with na, zn

Details for d3ckib_

PDB Entry: 3cki, 2.3 Å

PDB Description: crystal structure of the tace-n-timp-3 complex

PDB Compounds: (B:) Metalloproteinase inhibitor 3

SCOPe Domain Sequences for d3ckib_:

Sequence; same for both SEQRES and ATOM records:

>d3ckib_ b.40.3.0 (B:) automated matches {Homo sapiens}
ctcspshpqdafcnsdivirakvvgkklvkegpfgtlvytikqmkmyrgftkmphvqyih
teaseslcglklevnkyqylltgrvydgkmytglcnfverwdqltlsqrkglnyryhlgc
n

Timeline for d3ckib_:

• d3ckib_ is new in SCOPe 2.03-stable
  
• d3ckib_ appears in SCOPe 2.04
  
• d3ckib_ appears in the current release, SCOPe 2.08