Lineage for d3cjia_ (3cji A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431815Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2431816Protein automated matches [190988] (22 species)
    not a true protein
  7. 2431967Species Seneca valley virus [TaxId:390157] [188689] (3 PDB entries)
  8. 2431968Domain d3cjia_: 3cji A: [199192]
    automated match to d1tme1_
    complexed with ca

Details for d3cjia_

PDB Entry: 3cji (more details), 2.3 Å

PDB Description: Structure of Seneca Valley Virus-001
PDB Compounds: (A:) Polyprotein

SCOPe Domain Sequences for d3cjia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cjia_ b.121.4.0 (A:) automated matches {Seneca valley virus [TaxId: 390157]}
stdnaetgvieagntdtdfsgelaapgsnhtnvkflfdrsrllnvikvlekdavfprpfp
tqegaqqddgyfclltprptvasrpatrfglyanpsgsgvlantsldfnfyslacftyfr
sdlevtvvslepdlefavgwfpsgseyqassfvydqlhvpfhftgrtprafaskggkvsf
vlpwnsvssvlpvrwggasklssatrglpahadwgtiyafvprpnekkstavkhvavyir
yknarawcpsmlpfrsyk

SCOPe Domain Coordinates for d3cjia_:

Click to download the PDB-style file with coordinates for d3cjia_.
(The format of our PDB-style files is described here.)

Timeline for d3cjia_: