SCOPe 2.08: Domain d3cipa2: 3cip A:147-375

Lineage for d3cipa2 (3cip A:147-375)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Dictyostelium discoideum [225500] (2 PDB entries)

8. Domain d3cipa2: 3cip A:147-375 [199191]
   Other proteins in same PDB: d3cipa1, d3cipg2, d3cipg3
   automated match to d1d4xa2
   complexed with atp, ca, gol, mg, so4

Details for d3cipa2

PDB Entry: 3cip, 1.6 Å

PDB Description: complex of dictyostelium discoideum actin with gelsolin

PDB Compounds: (A:) Major actin

SCOPe Domain Sequences for d3cipa2:

Sequence; same for both SEQRES and ATOM records:

>d3cipa2 c.55.1.1 (A:147-375) automated matches {Dictyostelium discoideum}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaer
eivrdikeklayvaldfeaemqtaasssaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkcf

Timeline for d3cipa2:

• d3cipa2 first appeared in SCOPe 2.03
  
• d3cipa2 appears in SCOPe 2.07