![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (49 species) not a true protein |
![]() | Species Dictyostelium discoideum [225499] (2 PDB entries) |
![]() | Domain d3cipa1: 3cip A:5-146 [199190] Other proteins in same PDB: d3cipa2, d3cipg_ automated match to d1d4xa1 complexed with atp, ca, gol, mg, so4 |
PDB Entry: 3cip (more details), 1.6 Å
SCOPe Domain Sequences for d3cipa1:
Sequence, based on SEQRES records: (download)
>d3cipa1 c.55.1.0 (A:5-146) automated matches {Dictyostelium discoideum} vqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqskrgi ltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimf etfntpamyvaiqavlslyasg
>d3cipa1 c.55.1.0 (A:5-146) automated matches {Dictyostelium discoideum} vqalvidngsgmckagfagddapravfpsivgrprhtkdsyvgdeaqskrgiltlkypie hgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpam yvaiqavlslyasg
Timeline for d3cipa1: