Lineage for d2cgrh1 (2cgr H:1-117)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 546882Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 546956Domain d2cgrh1: 2cgr H:1-117 [19919]
    Other proteins in same PDB: d2cgrh2, d2cgrl1, d2cgrl2
    part of an anti-sweetener Fab
    complexed with gas

Details for d2cgrh1

PDB Entry: 2cgr (more details), 2.2 Å

PDB Description: local and transmitted conformational changes on complexation of an anti-sweetener fab

SCOP Domain Sequences for d2cgrh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cgrh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
rvqllesgaelmkpgasvqisckatgytfseywiewvkerpghglewigeilpgsgrtny
rekfkgkatftadtssntaymqlssltsedsavyyctrgyssmdywgqgtsvtvsaa

SCOP Domain Coordinates for d2cgrh1:

Click to download the PDB-style file with coordinates for d2cgrh1.
(The format of our PDB-style files is described here.)

Timeline for d2cgrh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cgrh2