![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries) Uniprot P01901 22-299 |
![]() | Domain d3ch1g2: 3ch1 G:182-276 [199185] Other proteins in same PDB: d3ch1a1, d3ch1b_, d3ch1d1, d3ch1e_, d3ch1g1, d3ch1h_, d3ch1j1, d3ch1k_ automated match to d1qlfa1 complexed with gol, so4 |
PDB Entry: 3ch1 (more details), 2.3 Å
SCOPe Domain Sequences for d3ch1g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ch1g2 b.1.1.2 (G:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpepltlrwep
Timeline for d3ch1g2: