SCOPe 2.03: Domain d3ch1g1: 3ch1 G:1-181

Lineage for d3ch1g1 (3ch1 G:1-181)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (25 PDB entries)

8. Domain d3ch1g1: 3ch1 G:1-181 [199184]
   Other proteins in same PDB: d3ch1a2, d3ch1b_, d3ch1d2, d3ch1e_, d3ch1g2, d3ch1h_, d3ch1j2, d3ch1k_
   automated match to d1qlfa2
   complexed with gol, so4

Details for d3ch1g1

PDB Entry: 3ch1, 2.3 Å

PDB Description: Crystal structure of H-2Db in complex with chimeric gp100

PDB Compounds: (G:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d3ch1g1:

Sequence, based on SEQRES records:

>d3ch1g1 d.19.1.1 (G:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Sequence, based on observed residues (ATOM records):

>d3ch1g1 d.19.1.1 (G:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgeepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnr

Timeline for d3ch1g1:

• d3ch1g1 is new in SCOPe 2.03-stable
  
• d3ch1g1 appears in SCOPe 2.04
  
• d3ch1g1 appears in the current release, SCOPe 2.08