Lineage for d3ch1d2 (3ch1 D:182-276)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1291448Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1291720Species Mouse (Mus musculus) [TaxId:10090] [88606] (101 PDB entries)
    Uniprot P01901 22-299
  8. 1291797Domain d3ch1d2: 3ch1 D:182-276 [199183]
    Other proteins in same PDB: d3ch1a1, d3ch1b_, d3ch1d1, d3ch1e_, d3ch1g1, d3ch1h_, d3ch1j1, d3ch1k_
    automated match to d1qlfa1
    complexed with gol, so4

Details for d3ch1d2

PDB Entry: 3ch1 (more details), 2.3 Å

PDB Description: Crystal structure of H-2Db in complex with chimeric gp100
PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d3ch1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ch1d2 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

SCOPe Domain Coordinates for d3ch1d2:

Click to download the PDB-style file with coordinates for d3ch1d2.
(The format of our PDB-style files is described here.)

Timeline for d3ch1d2: