Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
Domain d3cfic1: 3cfi C:6-116 [199176] Other proteins in same PDB: d3cfia_, d3cfib_, d3cfic2, d3cfid_, d3cfie_, d3cfif2, d3cfig_, d3cfih_, d3cfii2, d3cfij_, d3cfik_, d3cfil2 automated match to d3ezjb_ complexed with cl |
PDB Entry: 3cfi (more details), 2.58 Å
SCOPe Domain Sequences for d3cfic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cfic1 b.1.1.1 (C:6-116) automated matches {Llama (Lama glama) [TaxId: 9844]} esggglvqpggslrlscaasgfafsgyamswvrqapgkglewvsginrdgstsytapvkg rftisrdnaknilylqmnslrpedtavyycakwlggrdwydrgqgtqvtvs
Timeline for d3cfic1: