Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab HC19 (mouse), lambda L chain [48780] (4 PDB entries) |
Domain d2virb1: 2vir B:1-120 [19917] Other proteins in same PDB: d2vira2, d2virb2, d2virc_ |
PDB Entry: 2vir (more details), 3.25 Å
SCOP Domain Sequences for d2virb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2virb1 b.1.1.1 (B:1-120) Immunoglobulin (variable domains of L and H chains) {Fab HC19 (mouse), lambda L chain} qvqlkesgpglvapsqslsitctvsgfllisngvhwvrqppgkglewlgviwaggntnyn salmsrvsiskdnsksqvflkmkslqtddtamyycardfydydvfyyamdywgqgtsvtv
Timeline for d2virb1: