Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries) |
Domain d3c5ze2: 3c5z E:113-201 [199167] Other proteins in same PDB: d3c5za1, d3c5zb1, d3c5zc1, d3c5zc2, d3c5zd1, d3c5zd2, d3c5ze1, d3c5zf1, d3c5zg1, d3c5zg2, d3c5zh1, d3c5zh2 automated match to d1qrnd2 |
PDB Entry: 3c5z (more details), 2.55 Å
SCOPe Domain Sequences for d3c5ze2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c5ze2 b.1.1.2 (E:113-201) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
Timeline for d3c5ze2: