Lineage for d3c5ze2 (3c5z E:113-201)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753143Domain d3c5ze2: 3c5z E:113-201 [199167]
    Other proteins in same PDB: d3c5za1, d3c5zb1, d3c5zc1, d3c5zc2, d3c5zd1, d3c5zd2, d3c5ze1, d3c5zf1, d3c5zg1, d3c5zg2, d3c5zh1, d3c5zh2
    automated match to d1qrnd2

Details for d3c5ze2

PDB Entry: 3c5z (more details), 2.55 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr b3k506
PDB Compounds: (E:) TCR B3K506 Alpha Chain

SCOPe Domain Sequences for d3c5ze2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c5ze2 b.1.1.2 (E:113-201) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3c5ze2:

Click to download the PDB-style file with coordinates for d3c5ze2.
(The format of our PDB-style files is described here.)

Timeline for d3c5ze2: