![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d3c5ze1: 3c5z E:1-112 [199166] Other proteins in same PDB: d3c5za2, d3c5zb2, d3c5zc1, d3c5zc2, d3c5zd1, d3c5zd2, d3c5ze2, d3c5zf2, d3c5zg1, d3c5zg2, d3c5zh1, d3c5zh2 automated match to d1qrnd1 |
PDB Entry: 3c5z (more details), 2.55 Å
SCOPe Domain Sequences for d3c5ze1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c5ze1 b.1.1.0 (E:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dsvtqtegnvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg featydkgttsfhlrkasvqesdsavyycalvisntnkvvfgtgtrlqvlpn
Timeline for d3c5ze1: