SCOPe 2.04: Domain d3c5zb2: 3c5z B:113-240

Lineage for d3c5zb2 (3c5z B:113-240)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d3c5zb2: 3c5z B:113-240 [199165]
   Other proteins in same PDB: d3c5za1, d3c5zb1, d3c5zc1, d3c5zc2, d3c5zd1, d3c5zd2, d3c5ze1, d3c5zf1, d3c5zg1, d3c5zg2, d3c5zh1, d3c5zh2
   automated match to d1qsee2

Details for d3c5zb2

PDB Entry: 3c5z, 2.55 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr b3k506

PDB Compounds: (B:) TCR B3K506 Beta Chain

SCOPe Domain Sequences for d3c5zb2:

Sequence; same for both SEQRES and ATOM records:

>d3c5zb2 b.1.1.2 (B:113-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

Timeline for d3c5zb2:

• d3c5zb2 first appeared in SCOPe 2.03
  
• d3c5zb2 appears in SCOPe 2.05
  
• d3c5zb2 appears in the current release, SCOPe 2.08