SCOPe 2.03: Domain d3c5za1: 3c5z A:1-112

Lineage for d3c5za1 (3c5z A:1-112)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d3c5za1: 3c5z A:1-112 [199162]
   Other proteins in same PDB: d3c5za2, d3c5zb2, d3c5zc1, d3c5zc2, d3c5zd1, d3c5zd2, d3c5ze2, d3c5zf2, d3c5zg1, d3c5zg2, d3c5zh1, d3c5zh2
   automated match to d1qrnd1

Details for d3c5za1

PDB Entry: 3c5z, 2.55 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr b3k506

PDB Compounds: (A:) TCR B3K506 Alpha Chain

SCOPe Domain Sequences for d3c5za1:

Sequence; same for both SEQRES and ATOM records:

>d3c5za1 b.1.1.0 (A:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dsvtqtegnvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
featydkgttsfhlrkasvqesdsavyycalvisntnkvvfgtgtrlqvlpn

Timeline for d3c5za1:

• d3c5za1 is new in SCOPe 2.03-stable
  
• d3c5za1 appears in SCOPe 2.04
  
• d3c5za1 appears in the current release, SCOPe 2.08