Lineage for d3c5za1 (3c5z A:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760954Domain d3c5za1: 3c5z A:1-112 [199162]
    Other proteins in same PDB: d3c5za2, d3c5zb2, d3c5zc1, d3c5zc2, d3c5zd1, d3c5zd2, d3c5ze2, d3c5zf2, d3c5zg1, d3c5zg2, d3c5zh1, d3c5zh2
    automated match to d1qrnd1

Details for d3c5za1

PDB Entry: 3c5z (more details), 2.55 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr b3k506
PDB Compounds: (A:) TCR B3K506 Alpha Chain

SCOPe Domain Sequences for d3c5za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c5za1 b.1.1.0 (A:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dsvtqtegnvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
featydkgttsfhlrkasvqesdsavyycalvisntnkvvfgtgtrlqvlpn

SCOPe Domain Coordinates for d3c5za1:

Click to download the PDB-style file with coordinates for d3c5za1.
(The format of our PDB-style files is described here.)

Timeline for d3c5za1: