Lineage for d2vira1 (2vir A:1-110)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219770Species Fab HC19 (mouse), lambda L chain [48780] (4 PDB entries)
  8. 219777Domain d2vira1: 2vir A:1-110 [19916]
    Other proteins in same PDB: d2vira2, d2virb2, d2virc_

Details for d2vira1

PDB Entry: 2vir (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

SCOP Domain Sequences for d2vira1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vira1 b.1.1.1 (A:1-110) Immunoglobulin (variable domains of L and H chains) {Fab HC19 (mouse), lambda L chain}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlg

SCOP Domain Coordinates for d2vira1:

Click to download the PDB-style file with coordinates for d2vira1.
(The format of our PDB-style files is described here.)

Timeline for d2vira1: