SCOPe 2.06: Domain d3c34a_: 3c34 A:

Lineage for d3c34a_ (3c34 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (101 PDB entries)

8. Domain d3c34a_: 3c34 A: [199156]
   automated match to d3c32b_
   complexed with cl, gol, kai, rb

Details for d3c34a_

PDB Entry: 3c34, 1.82 Å

PDB Description: crystal structure of glur5 ligand-binding core in complex with rubidium at 1.82 angstrom resolution

PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 1

SCOPe Domain Sequences for d3c34a_:

Sequence; same for both SEQRES and ATOM records:

>d3c34a_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkyga
qndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpidsa
ddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvltt
dyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegkl
hmmkekwwrgngcp

Timeline for d3c34a_:

• d3c34a_ first appeared in SCOPe 2.03
  
• d3c34a_ appears in SCOPe 2.05
  
• d3c34a_ appears in SCOPe 2.07
  
• d3c34a_ appears in the current release, SCOPe 2.08