| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
| Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries) Uniprot P04896 39-388 |
| Domain d3c16c1: 3c16 C:36-63,C:180-366 [199151] Other proteins in same PDB: d3c16a_, d3c16b_, d3c16c2 automated match to d1azsc2 complexed with atp, ca, cl, fok, gsp, mg has additional subdomain(s) that are not in the common domain |
PDB Entry: 3c16 (more details), 2.87 Å
SCOPe Domain Sequences for d3c16c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c16c1 c.37.1.8 (C:36-63,C:180-366) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
athrllllgagesgkstivkqmrilhvnXvltsgifetkfqvdkvnfhmfdvggqrderr
kwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilfln
kqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristas
gdgrhycyphftcavdtenirrvfndcrdiiqrmhl
Timeline for d3c16c1: