Class a: All alpha proteins [46456] (286 folds) |
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) this domain interrupts the G-protein common fold |
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries) |
Domain d3c15c2: 3c15 C:86-201 [199149] Other proteins in same PDB: d3c15a_, d3c15b_, d3c15c1 automated match to d1azsc1 complexed with cl, fok, gsp, mg, pop |
PDB Entry: 3c15 (more details), 2.78 Å
SCOPe Domain Sequences for d3c15c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c15c2 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr
Timeline for d3c15c2: