SCOPe 2.05: Domain d3c14c2: 3c14 C:86-201

Lineage for d3c14c2 (3c14 C:86-201)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries)

8. Domain d3c14c2: 3c14 C:86-201 [199146]
   Other proteins in same PDB: d3c14a_, d3c14b_, d3c14c1
   automated match to d1azsc1
   complexed with ca, cl, fok, gsp, mg, pop

Details for d3c14c2

PDB Entry: 3c14, 2.68 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with pyrophosphate and ca

PDB Compounds: (C:) Guanine nucleotide-binding protein G(s) subunit alpha isoforms short

SCOPe Domain Sequences for d3c14c2:

Sequence; same for both SEQRES and ATOM records:

>d3c14c2 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe
fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

Timeline for d3c14c2:

• d3c14c2 first appeared in SCOPe 2.03
  
• d3c14c2 appears in SCOPe 2.04
  
• d3c14c2 appears in SCOPe 2.06
  
• d3c14c2 appears in the current release, SCOPe 2.08