![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
![]() | Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries) Uniprot P04896 39-388 |
![]() | Domain d3c14c1: 3c14 C:39-66,C:202-386 [199145] Other proteins in same PDB: d3c14a_, d3c14b_, d3c14c2 automated match to d1azsc2 complexed with ca, cl, fok, gsp, mg, pop |
PDB Entry: 3c14 (more details), 2.68 Å
SCOPe Domain Sequences for d3c14c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c14c1 c.37.1.8 (C:39-66,C:202-386) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} athrllllgagesgkstivkqmrilhvnXvltsgifetkfqvdkvnfhmfdvggqrderr kwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilfln kqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristas gdgrhycyphftcavdtenirrvfndcrdiiqrm
Timeline for d3c14c1: