![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) ![]() common fold is elaborated with additional secondary structures |
![]() | Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins) Pfam PF00211 structurally similar to the "palm" domain of DNA/RNA polymerase superfamily |
![]() | Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species) |
![]() | Species Dog (Canis familiaris) [TaxId:9615] [55078] (15 PDB entries) Uniprot P30803 458-646 |
![]() | Domain d3c14a_: 3c14 A: [199144] Other proteins in same PDB: d3c14b_, d3c14c1, d3c14c2 automated match to d1cs4a_ complexed with ca, cl, fok, gsp, mg, pop |
PDB Entry: 3c14 (more details), 2.68 Å
SCOPe Domain Sequences for d3c14a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c14a_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]} mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke hsietflil
Timeline for d3c14a_: