SCOPe 2.03: Domain d3c08l2: 3c08 L:107-211

Lineage for d3c08l2 (3c08 L:107-211)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d3c08l2: 3c08 L:107-211 [199143]
   Other proteins in same PDB: d3c08h1, d3c08h2, d3c08l1
   automated match to d1rhha2
   complexed with so4

Details for d3c08l2

PDB Entry: 3c08, 2.15 Å

PDB Description: crystal structure the fab fragment of matuzumab/emd72000 (fab72000)

PDB Compounds: (L:) Matuzumab Fab Light chain

SCOPe Domain Sequences for d3c08l2:

Sequence; same for both SEQRES and ATOM records:

>d3c08l2 b.1.1.2 (L:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d3c08l2:

• d3c08l2 is new in SCOPe 2.03-stable
  
• d3c08l2 appears in SCOPe 2.04
  
• d3c08l2 appears in the current release, SCOPe 2.08