Lineage for d3c08l1 (3c08 L:4-106)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296259Domain d3c08l1: 3c08 L:4-106 [199142]
    Other proteins in same PDB: d3c08h1, d3c08h2, d3c08l2
    automated match to d1rhha1
    complexed with so4

Details for d3c08l1

PDB Entry: 3c08 (more details), 2.15 Å

PDB Description: crystal structure the fab fragment of matuzumab/emd72000 (fab72000)
PDB Compounds: (L:) Matuzumab Fab Light chain

SCOPe Domain Sequences for d3c08l1:

Sequence, based on SEQRES records: (download)

>d3c08l1 b.1.1.0 (L:4-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtqspsslsasvgdrvtitcsasssvtymywyqqkpgkapklliydtsnlasgvpsrfsg
sgsgtdytftisslqpediatyycqqwsshiftfgqgtkveik

Sequence, based on observed residues (ATOM records): (download)

>d3c08l1 b.1.1.0 (L:4-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtqspsslsasvgdrvtitcsasvtymywyqqkpgkapklliydtsnlasgvpsrfsgsg
sgtdytftisslqpediatyycqqwsshiftfgqgtkveik

SCOPe Domain Coordinates for d3c08l1:

Click to download the PDB-style file with coordinates for d3c08l1.
(The format of our PDB-style files is described here.)

Timeline for d3c08l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c08l2