Lineage for d3c07b2 (3c07 B:90-229)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728100Protein Putative transcriptional regulator SCO4850 [158796] (1 species)
  7. 2728101Species Streptomyces coelicolor [TaxId:1902] [158797] (1 PDB entry)
    Uniprot Q9KZ96 90-235
  8. 2728103Domain d3c07b2: 3c07 B:90-229 [199141]
    Other proteins in same PDB: d3c07a1, d3c07b1
    automated match to d3c07a2
    complexed with so4

Details for d3c07b2

PDB Entry: 3c07 (more details), 2.7 Å

PDB Description: Crystal structure of a TetR family transcriptional regulator from Streptomyces coelicolor A3(2)
PDB Compounds: (B:) Putative tetR-family transcriptional regulator

SCOPe Domain Sequences for d3c07b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c07b2 a.121.1.1 (B:90-229) Putative transcriptional regulator SCO4850 {Streptomyces coelicolor [TaxId: 1902]}
tdlearlagvlkvwldiatpyhefavqffknaadpdsplspfspeseharveaigihrav
lagaktkvpeelrdilpelmwlsqmglvlywifdrtegrersyrlaergarltargvvla
rfrvlrplvrevhelftdfl

SCOPe Domain Coordinates for d3c07b2:

Click to download the PDB-style file with coordinates for d3c07b2.
(The format of our PDB-style files is described here.)

Timeline for d3c07b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c07b1