Lineage for d3c07b1 (3c07 B:16-89)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305653Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2305869Protein Putative transcriptional regulator SCO4850 [158258] (1 species)
  7. 2305870Species Streptomyces coelicolor [TaxId:1902] [158259] (1 PDB entry)
    Uniprot Q9KZ96 15-89
  8. 2305872Domain d3c07b1: 3c07 B:16-89 [199140]
    Other proteins in same PDB: d3c07a2, d3c07b2
    automated match to d3c07a1
    complexed with so4

Details for d3c07b1

PDB Entry: 3c07 (more details), 2.7 Å

PDB Description: Crystal structure of a TetR family transcriptional regulator from Streptomyces coelicolor A3(2)
PDB Compounds: (B:) Putative tetR-family transcriptional regulator

SCOPe Domain Sequences for d3c07b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c07b1 a.4.1.9 (B:16-89) Putative transcriptional regulator SCO4850 {Streptomyces coelicolor [TaxId: 1902]}
kseqtraliletamrlfqergydrttmraiaqeagvsvgnayyyfagkehliqgfydria
aehraavrevlare

SCOPe Domain Coordinates for d3c07b1:

Click to download the PDB-style file with coordinates for d3c07b1.
(The format of our PDB-style files is described here.)

Timeline for d3c07b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c07b2