SCOPe 2.08: Domain d3c07b1: 3c07 B:16-89

Lineage for d3c07b1 (3c07 B:16-89)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Putative transcriptional regulator SCO4850 [158258] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [158259] (1 PDB entry)
   Uniprot Q9KZ96 15-89

8. Domain d3c07b1: 3c07 B:16-89 [199140]
   Other proteins in same PDB: d3c07a2, d3c07b2
   automated match to d3c07a1
   complexed with so4

Details for d3c07b1

PDB Entry: 3c07, 2.7 Å

PDB Description: Crystal structure of a TetR family transcriptional regulator from Streptomyces coelicolor A3(2)

PDB Compounds: (B:) Putative tetR-family transcriptional regulator

SCOPe Domain Sequences for d3c07b1:

Sequence; same for both SEQRES and ATOM records:

>d3c07b1 a.4.1.9 (B:16-89) Putative transcriptional regulator SCO4850 {Streptomyces coelicolor [TaxId: 1902]}
kseqtraliletamrlfqergydrttmraiaqeagvsvgnayyyfagkehliqgfydria
aehraavrevlare

Timeline for d3c07b1:

• d3c07b1 first appeared in SCOPe 2.03
  
• d3c07b1 appears in SCOPe 2.07