![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species) VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries) |
![]() | Domain d2vita1: 2vit A:1-110 [19914] Other proteins in same PDB: d2vita2, d2vitb1, d2vitb2, d2vitc_ part of Fab HC19 complexed with zn; mutant |
PDB Entry: 2vit (more details), 3.25 Å
SCOPe Domain Sequences for d2vita1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vita1 b.1.1.1 (A:1-110) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]} qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlg
Timeline for d2vita1: