Lineage for d3bz2t_ (3bz2 T:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254847Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) (S)
    automatically mapped to Pfam PF01405
  5. 2254848Family f.23.34.1: PsbT-like [161030] (1 protein)
    Pfam PF01405
  6. 2254849Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)
  7. 2254850Species Thermosynechococcus elongatus [TaxId:146786] [161032] (7 PDB entries)
    Uniprot Q8DIQ0 1-30
  8. 2254856Domain d3bz2t_: 3bz2 T: [199139]
    Other proteins in same PDB: d3bz2a_, d3bz2b_, d3bz2c_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2i_, d3bz2j_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2u_, d3bz2v_, d3bz2x_, d3bz2z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2t_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d3bz2t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2t_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus elongatus [TaxId: 146786]}
metityvfifaciialfffaiffreppritkk

SCOPe Domain Coordinates for d3bz2t_:

Click to download the PDB-style file with coordinates for d3bz2t_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2t_: