Lineage for d3bz1c_ (3bz1 C:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1959793Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 1959794Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 1959795Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 1959804Protein Photosystem II CP43 protein PsbC [161081] (2 species)
  7. 1959805Species Thermosynechococcus elongatus [TaxId:146786] [161082] (3 PDB entries)
    Uniprot Q8DIF8 15-461
  8. 1959808Domain d3bz1c_: 3bz1 C: [199133]
    Other proteins in same PDB: d3bz1a_, d3bz1b_, d3bz1d_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1i_, d3bz1j_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1u_, d3bz1v_, d3bz1z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz1c_

PDB Entry: 3bz1 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 1 of 2). This file contains first monomer of PSII dimer
PDB Compounds: (C:) Photosystem II CP43 protein

SCOPe Domain Sequences for d3bz1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz1c_ f.55.1.1 (C:) Photosystem II CP43 protein PsbC {Thermosynechococcus elongatus [TaxId: 146786]}
dqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqgl
iliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyssf
fgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptldp
rvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafiw
sgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklga
nvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiqp
wqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwhag
raraaaagfekgidresepvlsmpsld

SCOPe Domain Coordinates for d3bz1c_:

Click to download the PDB-style file with coordinates for d3bz1c_.
(The format of our PDB-style files is described here.)

Timeline for d3bz1c_: