Lineage for d2visb1 (2vis B:1-120)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288402Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)
  8. 1288445Domain d2visb1: 2vis B:1-120 [19913]
    Other proteins in same PDB: d2visa1, d2visa2, d2visb2, d2visc_
    part of Fab HC19
    complexed with nag, zn; mutant

Details for d2visb1

PDB Entry: 2vis (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin, (escape) mutant with thr 131 replaced by ile, complexed with a neutralizing antibody
PDB Compounds: (B:) immunoglobulin (igg1, lambda)

SCOPe Domain Sequences for d2visb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2visb1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
qvqlkesgpglvapsqslsitctvsgfllisngvhwvrqppgkglewlgviwaggntnyn
salmsrvsiskdnsksqvflkmkslqtddtamyycardfydydvfyyamdywgqgtsvtv

SCOPe Domain Coordinates for d2visb1:

Click to download the PDB-style file with coordinates for d2visb1.
(The format of our PDB-style files is described here.)

Timeline for d2visb1: