Lineage for d3bytf2 (3byt F:119-237)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934366Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2934432Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 2934433Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
    Uniprot P23313
  8. 2934444Domain d3bytf2: 3byt F:119-237 [199129]
    Other proteins in same PDB: d3byta_, d3bytb1, d3bytc_, d3bytd1, d3byte_, d3bytf1, d3bytg_, d3byth1
    automated match to d1i4pa2

Details for d3bytf2

PDB Entry: 3byt (more details), 2.3 Å

PDB Description: A complex between a variant of staphylococcal enterotoxin C3 and the variable domain of the murine T cell receptor beta chain 8.2
PDB Compounds: (F:) Enterotoxin type C-3

SCOPe Domain Sequences for d3bytf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bytf2 d.15.6.1 (F:119-237) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
nhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

SCOPe Domain Coordinates for d3bytf2:

Click to download the PDB-style file with coordinates for d3bytf2.
(The format of our PDB-style files is described here.)

Timeline for d3bytf2: