Lineage for d3bueb_ (3bue B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420028Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1420088Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) (S)
    forms trimers with three closely packed beta-sheets
  5. 1420130Family d.74.2.0: automated matches [194896] (1 protein)
    not a true family
  6. 1420131Protein automated matches [194897] (1 species)
    not a true protein
  7. 1420132Species Mycobacterium tuberculosis [TaxId:83332] [194898] (3 PDB entries)
  8. 1420146Domain d3bueb_: 3bue B: [199117]
    automated match to d3buef_

Details for d3bueb_

PDB Entry: 3bue (more details), 2.15 Å

PDB Description: Crystal structure of the C-terminal domain hexamer of ArgR from Mycobacterium tuberculosis
PDB Compounds: (B:) Arginine repressor ArgR

SCOPe Domain Sequences for d3bueb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bueb_ d.74.2.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gtdrmarllgellvstddsgnlavlrtppgaahylasaidraalpqvvgtiagddtilvv
arepttgaqlagmfenlr

SCOPe Domain Coordinates for d3bueb_:

Click to download the PDB-style file with coordinates for d3bueb_.
(The format of our PDB-style files is described here.)

Timeline for d3bueb_: