SCOPe 2.08: Domain d3bn9e1: 3bn9 E:1-107

Lineage for d3bn9e1 (3bn9 E:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3bn9e1: 3bn9 E:1-107 [199111]
   Other proteins in same PDB: d3bn9a_, d3bn9b_, d3bn9c2, d3bn9d1, d3bn9d2, d3bn9e2, d3bn9f1, d3bn9f2
   automated match to d1rhha1
   complexed with edo, so4

Details for d3bn9e1

PDB Entry: 3bn9, 2.17 Å

PDB Description: crystal structure of mt-sp1 in complex with fab inhibitor e2

PDB Compounds: (E:) E2 Fab Light Chain

SCOPe Domain Sequences for d3bn9e1:

Sequence; same for both SEQRES and ATOM records:

>d3bn9e1 b.1.1.0 (E:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqgissylawyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfavyycqqhgnlpytfgdgtkveik

Timeline for d3bn9e1:

• d3bn9e1 first appeared in SCOPe 2.03
  
• d3bn9e1 appears in SCOPe 2.07