SCOP 1.55: Domain d1gigh1: 1gig H:1-120

Lineage for d1gigh1 (1gig H:1-120)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab HC19 (mouse), lambda L chain [48780] (4 PDB entries)

8. Domain d1gigh1: 1gig H:1-120 [19911]
   Other proteins in same PDB: d1gigh2, d1gigl2

Details for d1gigh1

PDB Entry: 1gig, 2.3 Å

PDB Description: refined three-dimensional structure of the fab fragment of a murine igg1, lambda antibody

SCOP Domain Sequences for d1gigh1:

Sequence; same for both SEQRES and ATOM records:

>d1gigh1 b.1.1.1 (H:1-120) Immunoglobulin (variable domains of L and H chains) {Fab HC19 (mouse), lambda L chain}
qvqlkesgpglvapsqslsitctvsgfllisngvhwvrqppgkglewlgviwaggntnyn
salmsrvsiskdnsksqvflkmkslqtddtamyycardfydydvfyyamdywgqgtsvtv

Timeline for d1gigh1:

• d1gigh1 appears in SCOP 1.57
  
• d1gigh1 appears in the current release, SCOPe 2.08