Lineage for d3bkml1 (3bkm L:1-106A)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759508Domain d3bkml1: 3bkm L:1-106A [199101]
    Other proteins in same PDB: d3bkmh_
    automated match to d1blna1
    complexed with na, zn

Details for d3bkml1

PDB Entry: 3bkm (more details), 1.6 Å

PDB Description: Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
PDB Compounds: (L:) WO2 IgG2a Fab fragment Light Chain Kappa

SCOPe Domain Sequences for d3bkml1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bkml1 b.1.1.0 (L:1-106A) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvnlgeqasiscrssqsivhsnghtylewylqrpgqspklliyqvstrf
sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqaslvpltfgagtklelk

SCOPe Domain Coordinates for d3bkml1:

Click to download the PDB-style file with coordinates for d3bkml1.
(The format of our PDB-style files is described here.)

Timeline for d3bkml1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bkml2
View in 3D
Domains from other chains:
(mouse over for more information)
d3bkmh_