Lineage for d3bkcl2 (3bkc L:107-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759576Domain d3bkcl2: 3bkc L:107-212 [199100]
    Other proteins in same PDB: d3bkch_
    automated match to d1blna2
    complexed with na

Details for d3bkcl2

PDB Entry: 3bkc (more details), 1.9 Å

PDB Description: Crystal structure of anti-amyloid beta FAB WO2 (P21, FormB)
PDB Compounds: (L:) WO2 IgG2a Fab fragment Light Chain Kappa

SCOPe Domain Sequences for d3bkcl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bkcl2 b.1.1.0 (L:107-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d3bkcl2:

Click to download the PDB-style file with coordinates for d3bkcl2.
(The format of our PDB-style files is described here.)

Timeline for d3bkcl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bkcl1
View in 3D
Domains from other chains:
(mouse over for more information)
d3bkch_