![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Human immunodeficiency virus 1 [TaxId:11676] [225129] (16 PDB entries) |
![]() | Domain d3bgra2: 3bgr A:430-552 [199092] Other proteins in same PDB: d3bgra1, d3bgra3, d3bgrb_ automated match to d1bqna1 protein/DNA complex; protein/RNA complex; complexed with edo, t27; mutant |
PDB Entry: 3bgr (more details), 2.1 Å
SCOPe Domain Sequences for d3bgra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bgra2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd klv
Timeline for d3bgra2: