Lineage for d3bgra1 (3bgr A:1-429)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016821Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 3016822Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. 3016866Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (206 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 3016936Domain d3bgra1: 3bgr A:1-429 [199091]
    Other proteins in same PDB: d3bgra2, d3bgra3
    automated match to d1bqna2
    protein/DNA complex; protein/RNA complex; complexed with edo, t27; mutant

Details for d3bgra1

PDB Entry: 3bgr (more details), 2.1 Å

PDB Description: crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3bgra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bgra1 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkknksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdivi
cqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d3bgra1:

Click to download the PDB-style file with coordinates for d3bgra1.
(The format of our PDB-style files is described here.)

Timeline for d3bgra1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3bgrb_