Lineage for d3bdyl2 (3bdy L:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751838Domain d3bdyl2: 3bdy L:108-213 [199089]
    Other proteins in same PDB: d3bdyh_, d3bdyl1, d3bdyv_
    automated match to d1rhha2
    complexed with gol

Details for d3bdyl2

PDB Entry: 3bdy (more details), 2.6 Å

PDB Description: dual specific bh1 fab in complex with vegf
PDB Compounds: (L:) Fab Fragment -Light Chain

SCOPe Domain Sequences for d3bdyl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdyl2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d3bdyl2:

Click to download the PDB-style file with coordinates for d3bdyl2.
(The format of our PDB-style files is described here.)

Timeline for d3bdyl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bdyl1