SCOPe 2.06: Domain d3bdyl1: 3bdy L:1-107

Lineage for d3bdyl1 (3bdy L:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3bdyl1: 3bdy L:1-107 [199088]
   Other proteins in same PDB: d3bdyl2, d3bdyv_
   automated match to d1rhha1
   complexed with gol

Details for d3bdyl1

PDB Entry: 3bdy, 2.6 Å

PDB Description: dual specific bh1 fab in complex with vegf

PDB Compounds: (L:) Fab Fragment -Light Chain

SCOPe Domain Sequences for d3bdyl1:

Sequence; same for both SEQRES and ATOM records:

>d3bdyl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdiprsisgyvawyqqkpgkapklliywgsylys
gvpsrfsgsgsgtdftltisslqpedfatyycqqhyttpptfgqgtkveik

Timeline for d3bdyl1:

• d3bdyl1 first appeared in SCOPe 2.03
  
• d3bdyl1 appears in SCOPe 2.05
  
• d3bdyl1 appears in SCOPe 2.07
  
• d3bdyl1 appears in the current release, SCOPe 2.08